General Information

  • ID:  hor007011
  • Uniprot ID:  P33090??1-198)
  • Protein name:  Prolactin
  • Gene name:  IFNT2
  • Organism:  Chelonia mydas
  • Family:  Somatotropin/prolactin family
  • Source:  Human
  • Expression:  Pituitary gland
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Testudines; Cryptodira; Chelonioidea; Cheloniidae; Chelonia.
  • GO MF:  GO:0005615 extracellular space
  • GO BP:  GO:0005179 hormone activity
  • GO CC:  GO:0008284 positive regulation of cell population proliferation; GO:0046427 positive regulation of receptor signaling pathway via JAK-STAT; GO:0031667 response to nutrient levels

Sequence Information

  • Sequence:  LPICPSGSVGCQVSLENLFDRAVKLSHYIHSLSSEMFNEFDERYAQGRGFLTKAINGCHTSSLTTPEDKEQAQQIHHEDLLNLVLGVLRSWNDPLLHLVSEVQSIKEAPDTILKAVEIEEQDKRLLEGMEKIVGQVHPGEIENELYSPWSGLPSLQQVDEDSRLFAFYNLLHCLRRDSHKIDNYLKLLKCRLIHDNDC
  • Length:  198
  • Propeptide:  LPICPSGSVGCQVSLENLFDRAVKLSHYIHSLSSEMFNEFDERYAQGRGFLTKAINGCHTSSLTTPEDKEQAQQIHHEDLLNLVLGVLRSWNDPLLHLVSEVQSIKEAPDTILKAVEIEEQDKRLLEGMEKIVGQVHPGEIENELYSPWSGLPSLQQVDEDSRLFAFYNLLHCLRRDSHKIDNYLKLLKCRLIHDNDC
  • Signal peptide:  NA
  • Modification:  T49 Glutamine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA